PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr021092.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 249aa    MW: 27135.4 Da    PI: 6.7806
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr021092.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.95.4e-418106199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk++rrkC+++Cv+apyfp +qp+kfanvh ++Gasnv k+l++l+   reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q++++l  +k
  Pbr021092.1   8 PCAACKFQRRKCTQECVFAPYFPPDQPQKFANVHTVYGASNVGKILNELNVAYREDAVTSLAYEAEARLRDPVYGCVGFISFLQNRLRQVQTDLYNAK 105
                  7********************************************************************************************98887 PP

       DUF260  99 e 99 
                  +
  Pbr021092.1 106 K 106
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9637108IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-408105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MSSNTHSPCA ACKFQRRKCT QECVFAPYFP PDQPQKFANV HTVYGASNVG KILNELNVAY  60
REDAVTSLAY EAEARLRDPV YGCVGFISFL QNRLRQVQTD LYNAKKDLSA YIGPQALMIP  120
LLGATTGPPP QQGCREGQLL IRDQHQQQLF EAHQQELVRF NINGMDAAAS LVNGNGFNQI  180
PAAAASKGVV SGSLGLGGAF DNNHYNQIEQ QAAAHHLNSL DHQLQAQLMF QPHPAALESQ  240
QKSVGEES*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009377477.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ36e-63LBD36_ARATH; LOB domain-containing protein 36
TrEMBLM5WIQ11e-109M5WIQ1_PRUPE; Uncharacterized protein
STRINGGLYMA11G06210.28e-70(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.19e-61ASYMMETRIC LEAVES 2-like 1